Required for resistance to DNA-damaging agents. UspA Protein, Salmonella typhi, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 19.9 kDa and the accession number is Q8Z268.

Salmonella typhi

E. coli

uspA,Universal stress protein A

AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE

2-144 aa

> 90% as determined by SDS-PAGE.

A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Required for resistance to DNA-damaging agents.