NKG2D/CD314 Protein, Pig, Recombinant (mFc) is expressed in Mammalian cell. The accession number is Q9GLF5.

Pig

HEK293 Cells

NKG2-D-activating NK receptor,NKG2-D type II integral membrane protein,NKG2D,NK cell receptor D,KLRK1,Killer cell lectin-like receptor subfamily K member 1,CD314

NLLFNQEAPSPLKESYCGPCPKNWICYRNSCYQFSNESKTWLQSQASCRSQNSSLLKIYSREDQDFFKLVKSYHWMGLVQIPTNRSWQWEDGSILSPNQITMVEMQNGSCAVYGSSFKGYTENCLTLNTYICMKRTV

78-214 aa

> 95% as determined by SDS-PAGE.

Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 83 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.