IFNAR1 Protein, M. auratus, Recombinant (His) is expressed in Mammalian cell. The accession number is A0A3Q0CXY4.

Mesocricetus auratus (Golden hamster)

HEK293 Cells

Ifnar1

DGEELEPPEDVDVYIVDDNLTLKWSHKGEPAGNVTFSAEYQTDEMENWLKLPGCHHVTGTECEFSLLNTNIYAEMKFRVRAETGKSTSSWAEVDPFIPFLRAHIGPPGVRLEAEDQAIVVDISYPGRGGKMWEGDTLRFQYRIVIWQRSSNETKTITTSYYTIKISKLLPETTYCLKVKAIHTFRGKHSNYSAVQCINTTEASKMPVPENIEMDALGESYVLRWDCAPADVSFRAQWLPNFYKSTSGSSPDKWKPIPACADIRTMQCVFPRNTIHTDHFLLRVQAFRGNNTSFWSEEKLINSQKYTKIPPPIVAVTPTRDSLLVYVSCQDHSLSKCRKLTYEVVFWDKTSNTKRRVVKESPEFTIENLQPQTVYCVQARVLSFATWNKSSDFSDALCDATRPGNSSS

25-431 aa

> 90% as determined by SDS-PAGE.

Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 153 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.