Defensin-like protein 1 Protein, Dahlia merckii, Recombinant (B2M & His) is expressed in E. coli.

Dahlia merckii

E. coli

DmAMP1,Defensin-like protein 1,Cysteine-rich antimicrobial protein 1,Defensin AMP1

ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC

1-50 aa

> 90% as determined by SDS-PAGE.

A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Possesses antimicrobial activity sensitive to inorganic cations. Has no inhibitory effect on insect gut alpha-amylase. Induces potential changes in fungal membranes and increased K+ efflux and Ca(2+) uptake. Interacts with sphingolipids and ergosterols found in fungal plasma membranes.