首页 工具


Search Results for " exendin-4 peptide derivative "


抑制剂 & 化合物



如果没找到您满意的产品或者您对产品有其他要求,可以联系我们专业顾问为您提供针对性的合理建议。     QQ咨询       网站留言咨询


Cat. No. Product Name Target Signaling Pathways
TP1161 Exendin-4 peptide derivative


FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.
TP1154 Exendin-4 peptide derivative acetate


Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative.

TP1366 Exendin-3/4 (59-86)

Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.


Others Others
KQMEEEAVRLFIEWLKNGGPSSGAPPPS is a Exendin-4 peptide derivative. Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce ...


Exendin-4 peptide derivative
Cat.No: TP1161
Exendin-4 peptide derivative acetate
Cat.No: TP1154
Cat.No: T75859
Exendin-3/4 (59-86)
Cat.No: TP1366
Cat.No: T75860
Cat.No: T36760
Target: Others
Cat. No. Product Name Species Expression System
TMPY-00749 FGF-2 Protein, Human, Recombinant

fibroblast growth factor 2 (basic),FGF-2,FGFB,HBGF-2,BFGF

Human E. coli
FGF-2 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 16.5 kDa and the accession number is P09038-4.
TMPK-00823 VEGF165 Protein, Human, Recombinant (His & Avi)


Human HEK293 Cells
Vascular endothelial growth factor (VEGF or VEGF-A), also known as vascular permeability factor (VPF), is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. VEGF165 appears to be the most abundant and potent isoform, followed by VEGF121 and VEGF189. VEGF165 Protein, Human, Recombinant (His & Avi) is expressed in HEK293 mammalian cells with C-His-Avi tag. The predicted molecular weight is 22.2 kDa and the accession number is P15692-4.
TMPJ-00864 VEGF165 Protein, Human, Recombinant

Vascular Endothelial Growth Factor Isoform 165,血管内皮生长因子,VEGF...

Human HEK293 Cells
Human Vascular endothelial growth factor (VEGF), also known as VEGF-A and vascular permeability factor (VPF), belongs to the platelet-derived growth factor family of cysteine-knot growth factors. It is a potent activator in vasculogenesis and angiogenesis both physiologically and pathologically. VEGF-A has 8 differently spliced isoforms, of which VEGF165 is the most abundant one. VEGF165 is a disulfide-linked homodimer consisting of two glycosylated 165 amino acid polypeptide chains. VEGF stimul...
TMPY-04911 VEGF165 Protein, Human, Recombinant (His & Avi), Biotinylated

vascular endothelial growth factor A,血管内皮生长因子

Human,Cynomolgus HEK293 Cells
VEGF165 Protein, Human, Recombinant (His & Avi), Biotinylated is expressed in HEK293 mammalian cells with His and Avi tag. The predicted molecular weight is 23.1 kDa and the accession number is P15692-4.
TMPY-02893 NT5C3A/NT5C3 Protein, Human, Recombinant


Human E. coli
NT5C3A (5'-Nucleotidase, Cytosolic IIIA) is a Protein Coding gene. This gene encodes a member of the 5'-nucleotidase family of enzymes that catalyze the dephosphorylation of nucleoside 5'-monophosphates. The encoded protein is the type 1 isozyme of pyrimidine 5' nucleotidase and catalyzes the dephosphorylation of pyrimidine 5' monophosphates. NT5C3A expression required both an intronic IFN-stimulated response element and the IFN-stimulated transcription factor IRF1. Overexpression of NT5C3A, but...
TMPK-00424 CD45 Protein, Human, Recombinant (His & Avi), Biotinylated


Human HEK293 Cells
PTPRC (also known as CD45),T cells require the protein tyrosine phosphatase CD45 to detect and respond to antigen because it activates the Src family kinase Lck, which phosphorylates the T cell antigen receptor (TCR) complex. CD45 ativates Lck by opposing the negative regulatory kinase Csk. Paradoxically, CD45 has also been implicated in suppressing TCR signaling by dephosphorylating the same signaling motifs within the TCR complex upon which Lck acts. CD45 Protein, Human, Recombinant (His & Avi...
TMPK-00822 VEGF165 Protein, Human, Recombinant (His & Avi), FITC-Labeled


Human HEK293 Cells
Vascular endothelial growth factor (VEGF or VEGF-A), also known as vascular permeability factor (VPF), is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. VEGF165 appears to be the most abundant and potent isoform, followed by VEGF121 and VEGF189. VEGF165 Protein, Human, Recombinant (His & Avi), FITC-Labeled is expressed in HEK293 mammalian cells with C-His-Avi tag. The predicted molecular weight is 22.2 kDa and the accession number is P15692-4.
TMPY-05598 Siglec-2/CD22 Protein, Human, Recombinant (hFc & Avi), Biotinylated

SIGLEC2,SIGLEC-2,CD22 molecule

Human HEK293 Cells
Siglec-2/CD22 Protein, Human, Recombinant (hFc & Avi), Biotinylated is expressed in HEK293 mammalian cells with hFc and Avi tag. The predicted molecular weight is 103.7 kDa and the accession number is P20273-4.
TMPY-04471 APEG1 Protein, Human, Recombinant (His)

SPEG complex locus,BPEG,SPEGalpha,SPEGβ,APEG-1,SPEGbeta,APEG...

Human E. coli
Striated muscle preferentially expressed protein kinase, also known as aortic preferentially expressed protein 1, APEG-1, SPEG and KIAA1297, is a protein that belongs to the protein kinase superfamily and CAMK Ser/Thr protein kinase family. SPEG / APEG-1 contains two fibronectin type-III domains, nine Ig-like (immunoglobulin-like) domains, two protein kinase domains. Isoform 1 of SPEG is preferentially expressed in striated muscle. Non-kinase form such as isoform 3 of SPEG is predominantly expre...
TMPJ-01333 TEM8/ANTXR1 Protein, Human, Recombinant (His)

ATR,ANTXR1,TEM8,Tumor Endothelial Marker 8,Anthrax Toxin Rec...

Human HEK293 Cells
Anthrax Toxin Receptor 1 (ANTXR1) is a single-pass type I membrane protein that belongs to the ATR family. ANTXR1 contains one VWFA domain and binds PA through the VWA domain. ANTXR1 is highly expressed in tumor endothelial cells. ANTXR1 plays a role in cell attachment and migration. ANTXR1 interacts with extracellular matrix proteins and the actin cytoskeleton, it mediates adhesion of cells to type 1 collagen and gelatin, reorganization of the actin cytoskeleton and promotes cell spreading. It ...
TMPK-00423 CD45 Protein, Human, Recombinant (His & Avi)


Human HEK293 Cells
PTPRC (also known as CD45),T cells require the protein tyrosine phosphatase CD45 to detect and respond to antigen because it activates the Src family kinase Lck, which phosphorylates the T cell antigen receptor (TCR) complex. CD45 ativates Lck by opposing the negative regulatory kinase Csk. Paradoxically, CD45 has also been implicated in suppressing TCR signaling by dephosphorylating the same signaling motifs within the TCR complex upon which Lck acts. CD45 Protein, Human, Recombinant (His & Avi...
TMPY-04754 CASK Protein, Human, Recombinant

CMG,LIN2,MRXSNA,CAMGUK,calcium/calmodulin-dependent serine p...

Human Baculovirus Insect Cells
CASK Protein, Human, Recombinant is expressed in Baculovirus insect cells. The predicted molecular weight is 102.1 kDa and the accession number is O14936-4.
TMPY-00225 CLEC9A Protein, Mouse, Recombinant (hFc)

C-type lectin domain family 9, member A,9830005G06Rik,DNGR-1

Mouse HEK293 Cells
CLEC9A Protein, Mouse, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 52.1 kDa and the accession number is Q8BRU4-4.
TMPY-01117 MRAP Protein, Human, Recombinant (hFc)

FALP,FGD2,melanocortin 2 receptor accessory protein,GCCD2,B2...

Human HEK293 Cells
MRAP (Melanocortin 2 Receptor Accessory Protein) is a Protein Coding gene. This gene encodes a melanocortin receptor-interacting protein. It belongs to the MRAP family. MRAP, which contains a single transmembrane domain, has a unique structure, an antiparallel homodimer. MRAP is a single transmembrane domain accessory protein and a critical component of the hypothamo pituitary-adrenal axis. MRAP is highly expressed in the adrenal gland and is essential for adrenocorticotropin hormone (ACTH) rece...
TMPJ-00782 Amyloid Precursor Protein, Human, Recombinant (hFc)

Amyloid Precursor,Amyloid Precursor Protein 695,APP695

Human HEK293 Cells
Amyloid precursor protein (APP) is a type I membrane protein with several isoforms due to alternative splicing, performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. Of the three major splice isoforms of APP (APP695, APP751, and APP770) APP695 is the predominant neuronal form from which Amyloid beta peptide and transcriptionally-active cleaved intracellular domain of APP (AICD) are preferentially generated by selective process...
TMPJ-00233 CD200R1/CRTR2 Protein, Human, Recombinant (His)

Cell Surface Glycoprotein CD200 Receptor 1,OX2R,MOX2R,CD200 ...

Human HEK293 Cells
Cell surface glycoprotein CD200 Receptor 1 (CD200R1) is the receptor for the CD200 (OX-2) membrane glycoprotein. CD200R1 contains one C2- type Ig-like domain and one V-type Ig-like domain within its extracellular domain and a PTB-signaling motif in cytoplasmic domain. CD200R1 and CD200 associate via their respective N-terminal Ig-like domains. CD200R1 is restricted primarily to mast cells, basophils, macrophages, and dendritic cells. It propagates inhibitory signals despite its lacking a cytopla...
TMPY-01823 PTK9 Protein, Human, Recombinant

MGC41876,twinfilin actin binding protein 1,A6,MGC23...

Human E. coli
PTK9 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 29 kDa and the accession number is Q12792-4.
TMPY-01033 IL-32 Protein, Human, Recombinant (isoform alpha, His)

IL-32δ,IL-32beta,IL32,TAIFc,IL-32γ,白介素,IL-32 Protein(isoform...

Human HEK293 Cells
IL-32 is a recently discovered cytokine that induces various proinflammatory cytokines (TNF-alpha, IL-1beta, IL-6) and chemokines in both human and mouse cells through the NF-kappaB and p38 MAPK inflammatory signal pathways. It is regulated robustly by other major proinflammatory cytokines and is crucial to inflammation and immune responses. Four of the IL-32 isoforms (alpha, beta, gamma, and delta) are the most representative IL-32 transcripts, and the gamma isoform of IL-32 is the most active,...
TMPY-00119 FLT1 Protein, Human, Recombinant (hFc)

VEGFR1,VEGFR-1,fms-related tyrosine kinase 1,FLT-1,FLT

Human HEK293 Cells
FLT1 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 61.1 kDa and the accession number is P17948-4.
TMPK-00702 ANTXR2 Protein, Human, Recombinant (His)


Human HEK293 Cells
The Capillary Morphogenesis Gene 2 (CMG2) gene encodes an Anthrax toxin receptor (ANTXR2),ANTXR2/CMG2 was originally identified as a result of up-regulation during capillary morphogenesis of endothelial cells (ECs) cultured in vitro. ANTXR2/CMG2 functions to promote endothelial proliferation and morphogenesis during sprouting angiogenesis, consistent with the endothelial expression of ANTXR2/CMG2 in several vascular beds.
TMPY-04565 SRPK3 Protein, Human, Recombinant (His & GST)

MSSK1,MGC102944,STK23,MSSK-1,SRSF protein ...

Human Baculovirus Insect Cells
Serine / threonine-protein kinase SRPK3, also known as Muscle-specific serine kinase 1, Serine/arginine-rich protein-specific kinase 3, SR-protein-specific kinase 3, Serine / threonine-protein kinase 23, MSSK-1, SRPK3 and MSSK1, is a member of the protein kinase superfamily and CMGC Ser / Thr protein kinase family. SRPK3 is a protein kinase belonging to serine/arginine protein kinases (SRPK) family, which phosphorylates serine / arginine repeat-containing proteins, and is controlled by a muscle-...
TMPY-04563 CASK Protein, Human, Recombinant (His & GST)

calcium/calmodulin-dependent serine protein kinase (MAGUK fa...

Human Baculovirus Insect Cells
CASK Protein, Human, Recombinant (His & GST) is expressed in Baculovirus insect cells with His and GST tag. The predicted molecular weight is 130 kDa and the accession number is O14936-4.
TMPY-01822 PTK9 Protein, Human, Recombinant (His & GST)

PTK9,MGC41876,A6,MGC23788,twinfilin actin binding p...

Human E. coli
PTK9 Protein, Human, Recombinant (His & GST) is expressed in E. coli expression system with His and GST tag. The predicted molecular weight is 57 kDa and the accession number is Q12792-4.
TMPY-01933 CHI3L2 Protein, Human, Recombinant (His)

YKL-39,CHIL2,chitinase 3 like 2,YKL39

Human HEK293 Cells
Chondrocyte protein 39 (YKL-39), also known as Chitinase 3-like 2 (CHI3L2), is a secretory protein of articular chondrocytes belonging to the glycosyl hydrolase 18 family. Its highest expression is in chondrocytes, followed by synoviocytes, lung and heart. YKL-39/CHI3L2 is not detected in spleen, pancreas, and liver. YKL-39/CHI3L2 may also be expressed in developing brain and placenta. YKL-39/CHI3L2, a cartilage-related protein, is found to induce arthritis accompanied by pathologic changes in b...
TMPY-00380 ANTXR2 Protein, Human, Recombinant (hFc)

HFS,JHF,anthrax toxin receptor 2,ISH,CMG-2,CMG2

Human HEK293 Cells
ANTXR2 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 57.4 kDa and the accession number is P58335-4.
TMPY-00711 CD45 Protein, Human, Recombinant (hFc)

GP180,L-CA,LY5,T200,protein tyrosine phosphatase, receptor t...

Human HEK293 Cells
CD45 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 71.1 kDa and the accession number is P08575-4.
TMPJ-00410 CD45R0 Protein, Human, Recombinant (His)

CD45 antigen,L-CA,protein tyrosine phosphatase, rec...

Human HEK293 Cells
CD45R0 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 80-120 KDa and the accession number is P08575-4.
TMPJ-01256 Caspase-10 Protein, Human, Recombinant (His)

CASP10,FAS-Associated Death Domain Protein Interleukin-1B-Co...

Human E. coli
Caspase-10 (CASP10) is a 521 amino acid protein member of the Cysteine-Aspartic Acid Protease (Caspase) family. CASP10 contains two DED (Death Effector) domains and is detectable in most tissues. CASP10 cleavage by Granzyme B and autocatalytic activity generate the two active subunits: Caspase-10 subunit p23/17, Caspase-10 subunit p12. Caspases are a family of cytosolic aspartate-specific cysteine proteases involved in the execution-phase of cell apoptosis, the initiation and execution. Human ca...
TMPJ-01188 CORO6 Protein, Human, Recombinant (His)


Human E. coli
Coronin 6, a newly identified member of the coronin family, is highly enriched at adult NMJs and regulates AChR clustering via modulating the interaction between receptors and the actin cytoskeletal network. Coronins are a family of conserved actin-binding proteins originally identified in the actin-rich structure of the amoeba Dictyostelium discoideum . To date, seven members of coronins have been identified in mammals, and most exhibit tissue-specific distribution patterns. Coronin 6 is promin...
TMPK-01362 SIRP alpha V4 Protein, Human, Recombinant (His & Avi), Biotinylated


Human HEK293 Cells
Signal regulatory protein α (SIRPα) is a regulatory membrane glycoprotein from SIRP family expressed mainly by myeloid cells and also by stem cells or neurons.SIRPα acts as inhibitory receptor and interacts with a broadly expressed transmembrane protein CD47 also called the "don´t eat me" signal.Cancer cells highly expressed CD47 that activate SIRP α and inhibit macrophage-mediated destruction. SIRP alpha V4 Protein, Human, Recombinant (His & Avi), Biotinylated is expressed in HEK293 mammalian c...
TMPK-01356 SIRP alpha V4 Protein, Human, Recombinant (His & Avi)


Human HEK293 Cells
Signal regulatory protein α (SIRPα) is a regulatory membrane glycoprotein from SIRP family expressed mainly by myeloid cells and also by stem cells or neurons.SIRPα acts as inhibitory receptor and interacts with a broadly expressed transmembrane protein CD47 also called the "don´t eat me" signal.Cancer cells highly expressed CD47 that activate SIRP α and inhibit macrophage-mediated destruction. SIRP alpha V4 Protein, Human, Recombinant (His & Avi) is expressed in HEK293 mammalian cells with C-Hi...
TMPK-01491 HLA-A*02:01&B2M&HBV (FLLTRILTI) Monomer Protein, Human, MHC (His & Avi), Biotinylated

MHC,HBV,Hepatitis B virus

Human HEK293 Cells
Hepatitis B virus (HBV), is the leading cause of liver diseases infecting an estimated 240 million persons worldwide. The HBV prevalence rates are variables between different countries, with an high level of endemicity in the south-eastern part of Europe. Seven main HBV-D subgenotypes have been described until now (D1-D7).
TMPK-01501 HLA-A*02:01&B2M&HBV (FLLTRILTI) Tetramer Protein, Human, MHC (His & Avi)

MHC,Hepatitis B virus,HBV

Human HEK293 Cells
Hepatitis B virus (HBV), is the leading cause of liver diseases infecting an estimated 240 million persons worldwide. The HBV prevalence rates are variables between different countries, with an high level of endemicity in the south-eastern part of Europe. Seven main HBV-D subgenotypes have been described until now (D1-D7).
TMPK-01505 HLA-A*02:01&B2M&HPV16 E7 (YMLDLQPET) Monomer Protein, Human, MHC (His & Avi), Biotinylated


Human HEK293 Cells
HPV16 E7 protein, one of the primary target proteins in molecular targeted therapy for HPV-induced cervical cancer. The affitoxin, ZHPV16E7 affitoxin384 was generated by fusing the modified Pseudomonas Exotoxin A (PE38KDEL) to the HPV16 E7-specific affibody.
TMPK-01492 HLA-A*02:01&B2M&HBV (FLLTRILTI) Monomer Protein, Human, MHC (His & Avi)

Hepatitis B virus,HBV,MHC

Human HEK293 Cells
Hepatitis B virus (HBV), is the leading cause of liver diseases infecting an estimated 240 million persons worldwide. The HBV prevalence rates are variables between different countries, with an high level of endemicity in the south-eastern part of Europe. Seven main HBV-D subgenotypes have been described until now (D1-D7).
TMPK-01504 HLA-A*02:01&B2M&HPV16 E7 (YMLDLQPET) Tetramer Protein, Human, MHC (His & Avi)


Human HEK293 Cells
HPV16 E7 protein, one of the primary target proteins in molecular targeted therapy for HPV-induced cervical cancer. The affitoxin, ZHPV16E7 affitoxin384 was generated by fusing the modified Pseudomonas Exotoxin A (PE38KDEL) to the HPV16 E7-specific affibody.
TMPK-01506 HLA-A*02:01&B2M&HPV16 E7 (YMLDLQPET) Monomer Protein, Human, MHC (His & Avi)


Human HEK293 Cells
HPV16 E7 protein, one of the primary target proteins in molecular targeted therapy for HPV-induced cervical cancer. The affitoxin, ZHPV16E7 affitoxin384 was generated by fusing the modified Pseudomonas Exotoxin A (PE38KDEL) to the HPV16 E7-specific affibody.


FGF-2 Protein, Human, Recombinant
Cat.No: TMPY-00749
Species: Human
Expression System: E. coli
VEGF165 Protein, Human, Recombinant (His & Avi)
Cat.No: TMPK-00823
Species: Human
Expression System: HEK293 Cells
VEGF165 Protein, Human, Recombinant
Cat.No: TMPJ-00864
Species: Human
Expression System: HEK293 Cells
VEGF165 Protein, Human, Recombinant (His & Avi), Biotinylated
Cat.No: TMPY-04911
Species: Human,Cynomolgus
Expression System: HEK293 Cells
NT5C3A/NT5C3 Protein, Human, Recombinant
Cat.No: TMPY-02893
Species: Human
Expression System: E. coli
CD45 Protein, Human, Recombinant (His & Avi), Biotinylated
Cat.No: TMPK-00424
Species: Human
Expression System: HEK293 Cells
VEGF165 Protein, Human, Recombinant (His & Avi), FITC-Labeled
Cat.No: TMPK-00822
Species: Human
Expression System: HEK293 Cells
Siglec-2/CD22 Protein, Human, Recombinant (hFc & Avi), Biotinylated
Cat.No: TMPY-05598
Species: Human
Expression System: HEK293 Cells
APEG1 Protein, Human, Recombinant (His)
Cat.No: TMPY-04471
Species: Human
Expression System: E. coli
TEM8/ANTXR1 Protein, Human, Recombinant (His)
Cat.No: TMPJ-01333
Species: Human
Expression System: HEK293 Cells
CD45 Protein, Human, Recombinant (His & Avi)
Cat.No: TMPK-00423
Species: Human
Expression System: HEK293 Cells
CASK Protein, Human, Recombinant
Cat.No: TMPY-04754
Species: Human
Expression System: Baculovirus Insect Cells
CLEC9A Protein, Mouse, Recombinant (hFc)
Cat.No: TMPY-00225
Species: Mouse
Expression System: HEK293 Cells
MRAP Protein, Human, Recombinant (hFc)
Cat.No: TMPY-01117
Species: Human
Expression System: HEK293 Cells
Amyloid Precursor Protein, Human, Recombinant (hFc)
Cat.No: TMPJ-00782
Species: Human
Expression System: HEK293 Cells
CD200R1/CRTR2 Protein, Human, Recombinant (His)
Cat.No: TMPJ-00233
Species: Human
Expression System: HEK293 Cells
PTK9 Protein, Human, Recombinant
Cat.No: TMPY-01823
Species: Human
Expression System: E. coli
IL-32 Protein, Human, Recombinant (isoform alpha, His)
Cat.No: TMPY-01033
Species: Human
Expression System: HEK293 Cells
FLT1 Protein, Human, Recombinant (hFc)
Cat.No: TMPY-00119
Species: Human
Expression System: HEK293 Cells
ANTXR2 Protein, Human, Recombinant (His)
Cat.No: TMPK-00702
Species: Human
Expression System: HEK293 Cells
SRPK3 Protein, Human, Recombinant (His & GST)
Cat.No: TMPY-04565
Species: Human
Expression System: Baculovirus Insect Cells
CASK Protein, Human, Recombinant (His & GST)
Cat.No: TMPY-04563
Species: Human
Expression System: Baculovirus Insect Cells
PTK9 Protein, Human, Recombinant (His & GST)
Cat.No: TMPY-01822
Species: Human
Expression System: E. coli
CHI3L2 Protein, Human, Recombinant (His)
Cat.No: TMPY-01933
Species: Human
Expression System: HEK293 Cells
ANTXR2 Protein, Human, Recombinant (hFc)
Cat.No: TMPY-00380
Species: Human
Expression System: HEK293 Cells
CD45 Protein, Human, Recombinant (hFc)
Cat.No: TMPY-00711
Species: Human
Expression System: HEK293 Cells
CD45R0 Protein, Human, Recombinant (His)
Cat.No: TMPJ-00410
Species: Human
Expression System: HEK293 Cells
Caspase-10 Protein, Human, Recombinant (His)
Cat.No: TMPJ-01256
Species: Human
Expression System: E. coli
CORO6 Protein, Human, Recombinant (His)
Cat.No: TMPJ-01188
Species: Human
Expression System: E. coli
SIRP alpha V4 Protein, Human, Recombinant (His & Avi), Biotinylated
Cat.No: TMPK-01362
Species: Human
Expression System: HEK293 Cells
SIRP alpha V4 Protein, Human, Recombinant (His & Avi)
Cat.No: TMPK-01356
Species: Human
Expression System: HEK293 Cells
HLA-A*02:01&B2M&HBV (FLLTRILTI) Monomer Protein, Human, MHC (His & Avi), Biotinylated
Cat.No: TMPK-01491
Species: Human
Expression System: HEK293 Cells
HLA-A*02:01&B2M&HBV (FLLTRILTI) Tetramer Protein, Human, MHC (His & Avi)
Cat.No: TMPK-01501
Species: Human
Expression System: HEK293 Cells
HLA-A*02:01&B2M&HPV16 E7 (YMLDLQPET) Monomer Protein, Human, MHC (His & Avi), Biotinylated
Cat.No: TMPK-01505
Species: Human
Expression System: HEK293 Cells
HLA-A*02:01&B2M&HBV (FLLTRILTI) Monomer Protein, Human, MHC (His & Avi)
Cat.No: TMPK-01492
Species: Human
Expression System: HEK293 Cells
HLA-A*02:01&B2M&HPV16 E7 (YMLDLQPET) Tetramer Protein, Human, MHC (His & Avi)
Cat.No: TMPK-01504
Species: Human
Expression System: HEK293 Cells
HLA-A*02:01&B2M&HPV16 E7 (YMLDLQPET) Monomer Protein, Human, MHC (His & Avi)
Cat.No: TMPK-01506
Species: Human
Expression System: HEK293 Cells
TargetMol Loading
