6
38
Cat. No. | Product Name | Target | Signaling Pathways |
---|---|---|---|
TP1161 |
Exendin-4 peptide derivative
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
||
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. | |||
TP1154 |
Exendin-4 peptide derivative acetate
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS,Exendin-4 peptide derivative |
||
Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative. | |||
T75859 |
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
|
||
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 是Exendin-4多肽衍生物。 | |||
TP1366 |
Exendin-3/4 (59-86)
|
||
Exendin-3/4 (59-86) is a Exendin-4 peptide derivative. | |||
T75860 |
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
|
||
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 是 Exendin-4多肽衍生物。 | |||
T36760 |
KQMEEEAVRLFIEWLKNGGPSSGAPPPS
|
Others | Others |
KQMEEEAVRLFIEWLKNGGPSSGAPPPS is a Exendin-4 peptide derivative. Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce ... |
Cat. No. | Product Name | Species | Expression System |
---|---|---|---|
TMPY-00749 |
FGF-2 Protein, Human, Recombinant
fibroblast growth factor 2 (basic),FGF-2,FGFB,HBGF-2,BFGF |
Human | E. coli |
FGF-2 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 16.5 kDa and the accession number is P09038-4. | |||
TMPJ-00864 |
VEGF165 Protein, Human, Recombinant
Vascular Endothelial Growth Factor Isoform 165,血管内皮生长因子,VEGF... |
Human | HEK293 Cells |
Human Vascular endothelial growth factor (VEGF), also known as VEGF-A and vascular permeability factor (VPF), belongs to the platelet-derived growth factor family of cysteine-knot growth factors. It is a potent activator in vasculogenesis and angiogenesis both physiologically and pathologically. VEGF-A has 8 differently spliced isoforms, of which VEGF165 is the most abundant one. VEGF165 is a disulfide-linked homodimer consisting of two glycosylated 165 amino acid polypeptide chains. VEGF stimul... | |||
TMPK-00823 |
VEGF165 Protein, Human, Recombinant (His & Avi)
血管内皮生长因子,RP1-261G23.1,MVCD1,MGC70609,VEGFA,VEGFMGC70609,VPF,... |
Human | HEK293 Cells |
Vascular endothelial growth factor (VEGF or VEGF-A), also known as vascular permeability factor (VPF), is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. VEGF165 appears to be the most abundant and potent isoform, followed by VEGF121 and VEGF189. VEGF165 Protein, Human, Recombinant (His & Avi) is expressed in HEK293 mammalian cells with C-His-Avi tag. The predicted molecular weight is 22.2 kDa and the accession number is P15692-4. | |||
TMPY-04911 |
VEGF165 Protein, Human, Recombinant (His & Avi), Biotinylated
vascular endothelial growth factor A,血管内皮生长因子 |
Human,Cynomolgus | HEK293 Cells |
VEGF165 Protein, Human, Recombinant (His & Avi), Biotinylated is expressed in HEK293 mammalian cells with His and Avi tag. The predicted molecular weight is 23.1 kDa and the accession number is P15692-4. | |||
TMPY-05598 |
Siglec-2/CD22 Protein, Human, Recombinant (hFc & Avi), Biotinylated
SIGLEC2,SIGLEC-2,CD22 molecule |
Human | HEK293 Cells |
Siglec-2/CD22 Protein, Human, Recombinant (hFc & Avi), Biotinylated is expressed in HEK293 mammalian cells with hFc and Avi tag. The predicted molecular weight is 103.7 kDa and the accession number is P20273-4. | |||
TMPY-04471 |
APEG1 Protein, Human, Recombinant (His)
SPEG complex locus,BPEG,SPEGalpha,SPEGβ,APEG-1,SPEGbeta,APEG... |
Human | E. coli |
Striated muscle preferentially expressed protein kinase, also known as aortic preferentially expressed protein 1, APEG-1, SPEG and KIAA1297, is a protein that belongs to the protein kinase superfamily and CAMK Ser/Thr protein kinase family. SPEG / APEG-1 contains two fibronectin type-III domains, nine Ig-like (immunoglobulin-like) domains, two protein kinase domains. Isoform 1 of SPEG is preferentially expressed in striated muscle. Non-kinase form such as isoform 3 of SPEG is predominantly expre... | |||
TMPJ-01333 |
TEM8/ANTXR1 Protein, Human, Recombinant (His)
ATR,ANTXR1,TEM8,Tumor Endothelial Marker 8,Anthrax Toxin Rec... |
Human | HEK293 Cells |
Anthrax Toxin Receptor 1 (ANTXR1) is a single-pass type I membrane protein that belongs to the ATR family. ANTXR1 contains one VWFA domain and binds PA through the VWA domain. ANTXR1 is highly expressed in tumor endothelial cells. ANTXR1 plays a role in cell attachment and migration. ANTXR1 interacts with extracellular matrix proteins and the actin cytoskeleton, it mediates adhesion of cells to type 1 collagen and gelatin, reorganization of the actin cytoskeleton and promotes cell spreading. It ... | |||
TMPK-00423 |
CD45 Protein, Human, Recombinant (His & Avi)
CD45R,LY5,EC 3.1.3.48,B220,CD45,T... |
Human | HEK293 Cells |
PTPRC (also known as CD45),T cells require the protein tyrosine phosphatase CD45 to detect and respond to antigen because it activates the Src family kinase Lck, which phosphorylates the T cell antigen receptor (TCR) complex. CD45 ativates Lck by opposing the negative regulatory kinase Csk. Paradoxically, CD45 has also been implicated in suppressing TCR signaling by dephosphorylating the same signaling motifs within the TCR complex upon which Lck acts. CD45 Protein, Human, Recombinant (His & Avi... | |||
TMPY-02893 |
NT5C3A/NT5C3 Protein, Human, Recombinant
P5N1,P5N-1,hUMP1,NT5C3,cN-III,PSN1,UMPH1,UMPH,POMP,5'-nucleo... |
Human | E. coli |
NT5C3A (5'-Nucleotidase, Cytosolic IIIA) is a Protein Coding gene. This gene encodes a member of the 5'-nucleotidase family of enzymes that catalyze the dephosphorylation of nucleoside 5'-monophosphates. The encoded protein is the type 1 isozyme of pyrimidine 5' nucleotidase and catalyzes the dephosphorylation of pyrimidine 5' monophosphates. NT5C3A expression required both an intronic IFN-stimulated response element and the IFN-stimulated transcription factor IRF1. Overexpression of NT5C3A, but... | |||
TMPK-00424 |
CD45 Protein, Human, Recombinant (His & Avi), Biotinylated
LCA,LY5,EC 3.1.3.48,CD45,L-CA,T200,CD4... |
Human | HEK293 Cells |
PTPRC (also known as CD45),T cells require the protein tyrosine phosphatase CD45 to detect and respond to antigen because it activates the Src family kinase Lck, which phosphorylates the T cell antigen receptor (TCR) complex. CD45 ativates Lck by opposing the negative regulatory kinase Csk. Paradoxically, CD45 has also been implicated in suppressing TCR signaling by dephosphorylating the same signaling motifs within the TCR complex upon which Lck acts. CD45 Protein, Human, Recombinant (His & Avi... | |||
TMPK-00822 |
VEGF165 Protein, Human, Recombinant (His & Avi), FITC-Labeled
RP1-261G23.1,VEGFA,MGC70609,VEGF,VEGFMGC70609,VPF,VAS,MVCD1,... |
Human | HEK293 Cells |
Vascular endothelial growth factor (VEGF or VEGF-A), also known as vascular permeability factor (VPF), is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. VEGF165 appears to be the most abundant and potent isoform, followed by VEGF121 and VEGF189. VEGF165 Protein, Human, Recombinant (His & Avi), FITC-Labeled is expressed in HEK293 mammalian cells with C-His-Avi tag. The predicted molecular weight is 22.2 kDa and the accession number is P15692-4. | |||
TMPY-01041 |
VEGF165 Protein, Human/Cynomolgus, Recombinant
Vascular permeability factor,L-VEGF,VEGF,VPF,VEGFA |
Human, Cynomolgus | Baculovirus Insect Cells |
VEGF165 Protein, Human/Cynomolgus, Recombinant is expressed in Baculovirus Insect Cells expression system. The predicted molecular weight is 19.2 kDa and the accession number is P15692-4. | |||
TMPY-04754 |
CASK Protein, Human, Recombinant
CMG,LIN2,MRXSNA,CAMGUK,calcium/calmodulin-dependent serine p... |
Human | Baculovirus Insect Cells |
CASK Protein, Human, Recombinant is expressed in Baculovirus insect cells. The predicted molecular weight is 102.1 kDa and the accession number is O14936-4. | |||
TMPY-00225 |
CLEC9A Protein, Mouse, Recombinant (hFc)
C-type lectin domain family 9, member A,9830005G06Rik,DNGR-1 |
Mouse | HEK293 Cells |
CLEC9A Protein, Mouse, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 52.1 kDa and the accession number is Q8BRU4-4. | |||
TMPY-01117 |
MRAP Protein, Human, Recombinant (hFc)
FALP,FGD2,melanocortin 2 receptor accessory protein,GCCD2,B2... |
Human | HEK293 Cells |
MRAP (Melanocortin 2 Receptor Accessory Protein) is a Protein Coding gene. This gene encodes a melanocortin receptor-interacting protein. It belongs to the MRAP family. MRAP, which contains a single transmembrane domain, has a unique structure, an antiparallel homodimer. MRAP is a single transmembrane domain accessory protein and a critical component of the hypothamo pituitary-adrenal axis. MRAP is highly expressed in the adrenal gland and is essential for adrenocorticotropin hormone (ACTH) rece... | |||
TMPJ-00782 |
Amyloid Precursor Protein, Human, Recombinant (hFc)
Amyloid Precursor,Amyloid Precursor Protein 695,APP695 |
Human | HEK293 Cells |
Amyloid precursor protein (APP) is a type I membrane protein with several isoforms due to alternative splicing, performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. Of the three major splice isoforms of APP (APP695, APP751, and APP770) APP695 is the predominant neuronal form from which Amyloid beta peptide and transcriptionally-active cleaved intracellular domain of APP (AICD) are preferentially generated by selective process... | |||
TMPJ-00233 |
CD200R1/CRTR2 Protein, Human, Recombinant (His)
Cell Surface Glycoprotein CD200 Receptor 1,OX2R,MOX2R,CD200 ... |
Human | HEK293 Cells |
Cell surface glycoprotein CD200 Receptor 1 (CD200R1) is the receptor for the CD200 (OX-2) membrane glycoprotein. CD200R1 contains one C2- type Ig-like domain and one V-type Ig-like domain within its extracellular domain and a PTB-signaling motif in cytoplasmic domain. CD200R1 and CD200 associate via their respective N-terminal Ig-like domains. CD200R1 is restricted primarily to mast cells, basophils, macrophages, and dendritic cells. It propagates inhibitory signals despite its lacking a cytopla... | |||
TMPY-01823 |
PTK9 Protein, Human, Recombinant
MGC41876,twinfilin actin binding protein 1,A6,MGC23... |
Human | E. coli |
PTK9 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 29 kDa and the accession number is Q12792-4. | |||
TMPY-01033 |
IL-32 Protein, Human, Recombinant (isoform alpha, His)
IL-32δ,IL-32beta,IL32,TAIFc,IL-32γ,白介素,IL-32 Protein(isoform... |
Human | HEK293 Cells |
IL-32 is a recently discovered cytokine that induces various proinflammatory cytokines (TNF-alpha, IL-1beta, IL-6) and chemokines in both human and mouse cells through the NF-kappaB and p38 MAPK inflammatory signal pathways. It is regulated robustly by other major proinflammatory cytokines and is crucial to inflammation and immune responses. Four of the IL-32 isoforms (alpha, beta, gamma, and delta) are the most representative IL-32 transcripts, and the gamma isoform of IL-32 is the most active,... | |||
TMPY-00119 |
FLT1 Protein, Human, Recombinant (hFc)
VEGFR1,VEGFR-1,fms-related tyrosine kinase 1,FLT-1,FLT |
Human | HEK293 Cells |
FLT1 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 61.1 kDa and the accession number is P17948-4. | |||
TMPK-00702 |
ANTXR2 Protein, Human, Recombinant (His)
cI-35,Antxr2,JHS,CMG-2,CMG2,JHF,HFS,ISH |
Human | HEK293 Cells |
The Capillary Morphogenesis Gene 2 (CMG2) gene encodes an Anthrax toxin receptor (ANTXR2),ANTXR2/CMG2 was originally identified as a result of up-regulation during capillary morphogenesis of endothelial cells (ECs) cultured in vitro. ANTXR2/CMG2 functions to promote endothelial proliferation and morphogenesis during sprouting angiogenesis, consistent with the endothelial expression of ANTXR2/CMG2 in several vascular beds. | |||
TMPY-04565 |
SRPK3 Protein, Human, Recombinant (His & GST)
MSSK1,MGC102944,STK23,MSSK-1,SRSF protein ... |
Human | Baculovirus Insect Cells |
Serine / threonine-protein kinase SRPK3, also known as Muscle-specific serine kinase 1, Serine/arginine-rich protein-specific kinase 3, SR-protein-specific kinase 3, Serine / threonine-protein kinase 23, MSSK-1, SRPK3 and MSSK1, is a member of the protein kinase superfamily and CMGC Ser / Thr protein kinase family. SRPK3 is a protein kinase belonging to serine/arginine protein kinases (SRPK) family, which phosphorylates serine / arginine repeat-containing proteins, and is controlled by a muscle-... | |||
TMPY-04563 |
CASK Protein, Human, Recombinant (His & GST)
calcium/calmodulin-dependent serine protein kinase (MAGUK fa... |
Human | Baculovirus Insect Cells |
CASK Protein, Human, Recombinant (His & GST) is expressed in Baculovirus insect cells with His and GST tag. The predicted molecular weight is 130 kDa and the accession number is O14936-4. | |||
TMPY-01822 |
PTK9 Protein, Human, Recombinant (His & GST)
PTK9,MGC41876,A6,MGC23788,twinfilin actin binding p... |
Human | E. coli |
PTK9 Protein, Human, Recombinant (His & GST) is expressed in E. coli expression system with His and GST tag. The predicted molecular weight is 57 kDa and the accession number is Q12792-4. | |||
TMPY-01933 |
CHI3L2 Protein, Human, Recombinant (His)
YKL-39,CHIL2,chitinase 3 like 2,YKL39 |
Human | HEK293 Cells |
Chondrocyte protein 39 (YKL-39), also known as Chitinase 3-like 2 (CHI3L2), is a secretory protein of articular chondrocytes belonging to the glycosyl hydrolase 18 family. Its highest expression is in chondrocytes, followed by synoviocytes, lung and heart. YKL-39/CHI3L2 is not detected in spleen, pancreas, and liver. YKL-39/CHI3L2 may also be expressed in developing brain and placenta. YKL-39/CHI3L2, a cartilage-related protein, is found to induce arthritis accompanied by pathologic changes in b... | |||
TMPY-00380 |
ANTXR2 Protein, Human, Recombinant (hFc)
HFS,JHF,anthrax toxin receptor 2,ISH,CMG-2,CMG2 |
Human | HEK293 Cells |
ANTXR2 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 57.4 kDa and the accession number is P58335-4. | |||
TMPY-00711 |
CD45 Protein, Human, Recombinant (hFc)
GP180,L-CA,LY5,T200,protein tyrosine phosphatase, receptor t... |
Human | HEK293 Cells |
CD45 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 71.1 kDa and the accession number is P08575-4. | |||
TMPJ-00410 |
CD45R0 Protein, Human, Recombinant (His)
CD45 antigen,L-CA,protein tyrosine phosphatase, rec... |
Human | HEK293 Cells |
CD45R0 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 80-120 KDa and the accession number is P08575-4. | |||
TMPJ-01256 |
Caspase-10 Protein, Human, Recombinant (His)
CASP10,FAS-Associated Death Domain Protein Interleukin-1B-Co... |
Human | E. coli |
Caspase-10 (CASP10) is a 521 amino acid protein member of the Cysteine-Aspartic Acid Protease (Caspase) family. CASP10 contains two DED (Death Effector) domains and is detectable in most tissues. CASP10 cleavage by Granzyme B and autocatalytic activity generate the two active subunits: Caspase-10 subunit p23/17, Caspase-10 subunit p12. Caspases are a family of cytosolic aspartate-specific cysteine proteases involved in the execution-phase of cell apoptosis, the initiation and execution. Human ca... | |||
TMPJ-01188 |
CORO6 Protein, Human, Recombinant (His)
Coronin-6,Clipin-E,CORO6 |
Human | E. coli |
Coronin 6, a newly identified member of the coronin family, is highly enriched at adult NMJs and regulates AChR clustering via modulating the interaction between receptors and the actin cytoskeletal network. Coronins are a family of conserved actin-binding proteins originally identified in the actin-rich structure of the amoeba Dictyostelium discoideum . To date, seven members of coronins have been identified in mammals, and most exhibit tissue-specific distribution patterns. Coronin 6 is promin... | |||
TMPK-01362 |
SIRP alpha V4 Protein, Human, Recombinant (His & Avi), Biotinylated
MYD1,SIRP α V4,PTPNS1,BIT,SHPS1,SIRP alpha,SHPS-1,S... |
Human | HEK293 Cells |
Signal regulatory protein α (SIRPα) is a regulatory membrane glycoprotein from SIRP family expressed mainly by myeloid cells and also by stem cells or neurons.SIRPα acts as inhibitory receptor and interacts with a broadly expressed transmembrane protein CD47 also called the "don´t eat me" signal.Cancer cells highly expressed CD47 that activate SIRP α and inhibit macrophage-mediated destruction. SIRP alpha V4 Protein, Human, Recombinant (His & Avi), Biotinylated is expressed in HEK293 mammalian c... | |||
TMPK-01356 |
SIRP alpha V4 Protein, Human, Recombinant (His & Avi)
BIT,SIRP α V4,MFR,SHPS1,SIRPA,SIRP α,P84,M... |
Human | HEK293 Cells |
Signal regulatory protein α (SIRPα) is a regulatory membrane glycoprotein from SIRP family expressed mainly by myeloid cells and also by stem cells or neurons.SIRPα acts as inhibitory receptor and interacts with a broadly expressed transmembrane protein CD47 also called the "don´t eat me" signal.Cancer cells highly expressed CD47 that activate SIRP α and inhibit macrophage-mediated destruction. SIRP alpha V4 Protein, Human, Recombinant (His & Avi) is expressed in HEK293 mammalian cells with C-Hi... | |||
TMPK-01491 |
HLA-A*02:01&B2M&HBV (FLLTRILTI) Monomer Protein, Human, MHC (His & Avi), Biotinylated
MHC,HBV,Hepatitis B virus |
Human | HEK293 Cells |
Hepatitis B virus (HBV), is the leading cause of liver diseases infecting an estimated 240 million persons worldwide. The HBV prevalence rates are variables between different countries, with an high level of endemicity in the south-eastern part of Europe. Seven main HBV-D subgenotypes have been described until now (D1-D7). | |||
TMPK-01501 |
HLA-A*02:01&B2M&HBV (FLLTRILTI) Tetramer Protein, Human, MHC (His & Avi)
MHC,Hepatitis B virus,HBV |
Human | HEK293 Cells |
Hepatitis B virus (HBV), is the leading cause of liver diseases infecting an estimated 240 million persons worldwide. The HBV prevalence rates are variables between different countries, with an high level of endemicity in the south-eastern part of Europe. Seven main HBV-D subgenotypes have been described until now (D1-D7). | |||
TMPK-01505 |
HLA-A*02:01&B2M&HPV16 E7 (YMLDLQPET) Monomer Protein, Human, MHC (His & Avi), Biotinylated
E7,MHC,HPV16 |
Human | HEK293 Cells |
HPV16 E7 protein, one of the primary target proteins in molecular targeted therapy for HPV-induced cervical cancer. The affitoxin, ZHPV16E7 affitoxin384 was generated by fusing the modified Pseudomonas Exotoxin A (PE38KDEL) to the HPV16 E7-specific affibody. | |||
TMPK-01492 |
HLA-A*02:01&B2M&HBV (FLLTRILTI) Monomer Protein, Human, MHC (His & Avi)
Hepatitis B virus,HBV,MHC |
Human | HEK293 Cells |
Hepatitis B virus (HBV), is the leading cause of liver diseases infecting an estimated 240 million persons worldwide. The HBV prevalence rates are variables between different countries, with an high level of endemicity in the south-eastern part of Europe. Seven main HBV-D subgenotypes have been described until now (D1-D7). | |||
TMPK-01504 |
HLA-A*02:01&B2M&HPV16 E7 (YMLDLQPET) Tetramer Protein, Human, MHC (His & Avi)
MHC,HPV16,E7 |
Human | HEK293 Cells |
HPV16 E7 protein, one of the primary target proteins in molecular targeted therapy for HPV-induced cervical cancer. The affitoxin, ZHPV16E7 affitoxin384 was generated by fusing the modified Pseudomonas Exotoxin A (PE38KDEL) to the HPV16 E7-specific affibody. | |||
TMPK-01506 |
HLA-A*02:01&B2M&HPV16 E7 (YMLDLQPET) Monomer Protein, Human, MHC (His & Avi)
HPV16,E7,MHC |
Human | HEK293 Cells |
HPV16 E7 protein, one of the primary target proteins in molecular targeted therapy for HPV-induced cervical cancer. The affitoxin, ZHPV16E7 affitoxin384 was generated by fusing the modified Pseudomonas Exotoxin A (PE38KDEL) to the HPV16 E7-specific affibody. |