1
3
Cat. No. | Product Name | Target | Signaling Pathways |
---|---|---|---|
T37695 |
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
|
||
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ, an ACE2-related peptide, serves as a valuable research tool for comprehending ACE2 functions. |
Cat. No. | Product Name | Species | Expression System |
---|---|---|---|
TMPJ-00696 |
NOL3 Protein, Human, Recombinant
Apoptosis Repressor With CARD,Nucleolar Protein of 30 kDa,Nu... |
Human | E. coli |
Nucleolar protein 3 is encoded by NOL3 gene. Multiple transcript variants encoding different isoforms have been found for this gene. So far, Nucleolar protein 3 has show to have two Isoforms. Isoform 1 may be involved in RNA splicing. Isoform 2 functions as an apoptosis repressor that blocks multiple modes of cell death. It inhibits extrinsic apoptotic pathways through two different ways. Firstly, it by interacting with FAS and FADD upon FAS activation blocking death-inducing signaling complex ... | |||
TMPJ-00697 |
NOL3 Protein, Human, Recombinant (GST)
Nop30,Myp,NOP,Apoptosis Repressor With CARD,Nucleol... |
Human | E. coli |
Nucleolar Protein 3 is encoded by NOL3 gene; multiple transcript variants encoding different isoforms have been found for this gene. So far, Nucleolar protein 3 has show to have two Isoforms. Isoform 1 may be involved in RNA splicing.Isoform 2 may inhibit apoptosis.It has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53. | |||
TMPY-01233 |
LRPAP1 Protein, Human, Recombinant (His)
HBP44,MYP23,low density lipoprotein receptor-relate... |
Human | HEK293 Cells |
LRPAP1 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 39.2 kDa and the accession number is P30533. |